HGF Antikörper
-
- Target Alle HGF Antikörper anzeigen
- HGF (Hepatocyte Growth Factor (Hepapoietin A, Scatter Factor) (HGF))
-
Reaktivität
- Human, Ratte, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HGF Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- HGF antibody was raised using a synthetic peptide corresponding to a region with amino acids GESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDG
- Top Product
- Discover our top product HGF Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HGF Blocking Peptide, catalog no. 33R-3251, is also available for use as a blocking control in assays to test for specificity of this HGF antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HGF antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HGF (Hepatocyte Growth Factor (Hepapoietin A, Scatter Factor) (HGF))
- Andere Bezeichnung
- HGF (HGF Produkte)
- Synonyme
- DFNB39 antikoerper, F-TCF antikoerper, HGFB antikoerper, HPTA antikoerper, SF antikoerper, HGF antikoerper, C230052L06Rik antikoerper, HGF/SF antikoerper, NK1 antikoerper, NK2 antikoerper, SF/HGF antikoerper, hepatocyte growth factor antikoerper, HGF antikoerper, Hgf antikoerper
- Hintergrund
- Hepatocyte growth factor regulates cell growth, cell motility, and morphogenesis by activating a tyrosine kinase signaling cascade after binding to the proto-oncogenic c-Met receptor. Hepatocyte growth factor is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. Its ability to stimulate mitogenesis, cell motility, and matrix invasion gives it a central role in angiogenesis, tumorogenesis, and tissue regeneration. It is secreted as a single inactive polypeptide and is cleaved by serine proteases into a 69 kDa alpha-chain and 34 kDa beta-chain. A disulfide bond between the alpha and beta chains produces the active, heterodimeric molecule. The protein belongs to the plasminogen subfamily of S1 peptidases but has no detectable protease activity.
- Molekulargewicht
- 26 kDa (MW of target protein)
- Pathways
- RTK Signalweg, Carbohydrate Homeostasis, Glycosaminoglycan Metabolic Process, Synaptic Membrane, Signaling of Hepatocyte Growth Factor Receptor
-