Inhibin alpha Antikörper (N-Term)

Produktnummer ABIN634265

Produktdetails anti-Inhibin alpha Antikörper

Target: Inhibin alpha (INHA) (Inhibin, alpha (INHA))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Inhibin alpha Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Inhibin Alpha antibody was raised against the N terminal of INHA

Aufreinigung: Affinity purified

Immunogen: Inhibin Alpha antibody was raised using the N terminal of INHA corresponding to a region with amino acids GLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Inhibin Alpha Blocking Peptide, catalog no. 33R-3384, is also available for use as a blocking control in assays to test for specificity of this Inhibin Alpha antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INHA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Inhibin alpha

Target: Inhibin alpha (INHA) (Inhibin, alpha (INHA))

Andere Bezeichnung: Inhibin alpha (INHA Produkte)

Synonyme: si:dkey-91f15.2 antikoerper, INHA antikoerper, MGC108500 antikoerper, AW555078 antikoerper, inhibin, alpha antikoerper, inhibin alpha subunit antikoerper, inhibin alpha antikoerper, inhibin alpha L homeolog antikoerper, inha antikoerper, INHA antikoerper, inha.L antikoerper, Inha antikoerper

Hintergrund: INHA joins either the beta A or beta B subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumour-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. However, in prostate cancer, expression of the inhibin alpha-subunit gene was suppressed and was not detectable in poorly differentiated tumor cells. Furthermore, because expression in gonadal and various extragonadal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth/differentiation factor and a hormone.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism, Hormone Activity, Negative Regulation of Hormone Secretion