PMS2 Antikörper
-
- Target Alle PMS2 Antikörper anzeigen
- PMS2 (PMS2 Postmeiotic Segregation Increased 2 (S. Cerevisiae) (PMS2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PMS2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PMS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids INKKVVPLDFSMSSLAKRIKQLHHEAQQSEGEQNYRKFRAKICPGENQAA
- Top Product
- Discover our top product PMS2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PMS2 Blocking Peptide, catalog no. 33R-4074, is also available for use as a blocking control in assays to test for specificity of this PMS2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PMS2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PMS2 (PMS2 Postmeiotic Segregation Increased 2 (S. Cerevisiae) (PMS2))
- Andere Bezeichnung
- PMS2 (PMS2 Produkte)
- Synonyme
- HNPCC4 antikoerper, PMS2CL antikoerper, PMSL2 antikoerper, AW555130 antikoerper, Pmsl2 antikoerper, PMS1 homolog 2, mismatch repair system component antikoerper, PMS1 homolog2, mismatch repair system component antikoerper, mismatch repair endonuclease PMS2 antikoerper, PMS2 antikoerper, Pms2 antikoerper, LOC463257 antikoerper, LOC107984056 antikoerper
- Hintergrund
- PMS2 is involved in DNA mismatch repair. It forms a heterodimer with MLH1 and this complex interacts with other complexes bound to mismatched bases. Mutations in this gene are associated with hereditary nonpolyposis colorectal cancer, Turcot syndrome, and are a cause of supratentorial primitive neuroectodermal tumors.
- Molekulargewicht
- 96 kDa (MW of target protein)
- Pathways
- DNA Reparatur, Production of Molecular Mediator of Immune Response
-