PMS2 Antikörper

Produktnummer ABIN634259

Produktdetails anti-PMS2 Antikörper

Target: PMS2 (PMS2 Postmeiotic Segregation Increased 2 (S. Cerevisiae) (PMS2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PMS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PMS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids INKKVVPLDFSMSSLAKRIKQLHHEAQQSEGEQNYRKFRAKICPGENQAA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PMS2 Blocking Peptide, catalog no. 33R-4074, is also available for use as a blocking control in assays to test for specificity of this PMS2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PMS2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PMS2

Target: PMS2 (PMS2 Postmeiotic Segregation Increased 2 (S. Cerevisiae) (PMS2))

Andere Bezeichnung: PMS2 (PMS2 Produkte)

Synonyme: HNPCC4 antikoerper, PMS2CL antikoerper, PMSL2 antikoerper, AW555130 antikoerper, Pmsl2 antikoerper, PMS1 homolog 2, mismatch repair system component antikoerper, PMS1 homolog2, mismatch repair system component antikoerper, mismatch repair endonuclease PMS2 antikoerper, PMS2 antikoerper, Pms2 antikoerper, LOC463257 antikoerper, LOC107984056 antikoerper

Hintergrund: PMS2 is involved in DNA mismatch repair. It forms a heterodimer with MLH1 and this complex interacts with other complexes bound to mismatched bases. Mutations in this gene are associated with hereditary nonpolyposis colorectal cancer, Turcot syndrome, and are a cause of supratentorial primitive neuroectodermal tumors.

Molekulargewicht: 96 kDa (MW of target protein)

Pathways: DNA Reparatur, Production of Molecular Mediator of Immune Response