TdT Antikörper (Middle Region)
-
- Target Alle TdT (DNTT) Antikörper anzeigen
- TdT (DNTT) (Deoxynucleotidyltransferase, terminal (DNTT))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TdT Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DNTT antibody was raised against the middle region of DNTT
- Aufreinigung
- Affinity purified
- Immunogen
- DNTT antibody was raised using the middle region of DNTT corresponding to a region with amino acids LRRYATHERKMILDNHALYDKTKRIFLKAESEEEIFAHLGLDYIEPWERN
- Top Product
- Discover our top product DNTT Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DNTT Blocking Peptide, catalog no. 33R-5388, is also available for use as a blocking control in assays to test for specificity of this DNTT antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNTT antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TdT (DNTT) (Deoxynucleotidyltransferase, terminal (DNTT))
- Andere Bezeichnung
- DNTT (DNTT Produkte)
- Synonyme
- TdT antikoerper, TDT antikoerper, BB160593 antikoerper, Tdt antikoerper, dntt-A antikoerper, dntt antikoerper, DNA nucleotidylexotransferase antikoerper, deoxynucleotidyltransferase, terminal antikoerper, DNA nucleotidylexotransferase L homeolog antikoerper, terminal deoxynucleotidyl transferase antikoerper, DNTT antikoerper, dntt antikoerper, Dntt antikoerper, dntt.L antikoerper, tdt antikoerper
- Hintergrund
- DNTT is the template-independent DNA polymerase which catalyzes the random addition of deoxynucleoside 5'-triphosphate to the 3'-end of a DNA initiator. One of the in vivo functions of this enzyme is the addition of nucleotides at the junction (N region) of rearranged Ig heavy chain and T-cell receptor geneegments during the maturation of B- and T-cells.
- Molekulargewicht
- 58 kDa (MW of target protein)
- Pathways
- DNA Reparatur
-