PAFAH1B1 Antikörper (N-Term)

Produktnummer ABIN634232

Produktdetails anti-PAFAH1B1 Antikörper

Target: PAFAH1B1 (Platelet-Activating Factor Acetylhydrolase 1b, Regulatory Subunit 1 (45kDa) (PAFAH1B1))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PAFAH1B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PAFAH1 B1 antibody was raised against the N terminal of PAFAH1 1

Aufreinigung: Affinity purified

Immunogen: PAFAH1 B1 antibody was raised using the N terminal of PAFAH1 1 corresponding to a region with amino acids MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PAFAH1B1 Blocking Peptide, catalog no. 33R-6595, is also available for use as a blocking control in assays to test for specificity of this PAFAH1B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAFAH0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PAFAH1B1

Target: PAFAH1B1 (Platelet-Activating Factor Acetylhydrolase 1b, Regulatory Subunit 1 (45kDa) (PAFAH1B1))

Andere Bezeichnung: PAFAH1B1 (PAFAH1B1 Produkte)

Synonyme: LIS1 antikoerper, LIS2 antikoerper, MDCR antikoerper, MDS antikoerper, PAFAH antikoerper, LIS-1 antikoerper, Lis1 antikoerper, MMS10-U antikoerper, Mdsh antikoerper, Ms10u antikoerper, Pafaha antikoerper, lis2 antikoerper, mdcr antikoerper, mds antikoerper, pafah antikoerper, pafah1b1-b antikoerper, PAFAHA antikoerper, Lis1a antikoerper, platelet activating factor acetylhydrolase 1b regulatory subunit 1 antikoerper, platelet-activating factor acetylhydrolase, isoform 1b, subunit 1 antikoerper, platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 antikoerper, platelet activating factor acetylhydrolase 1b regulatory subunit 1 L homeolog antikoerper, platelet-activating factor acetylhydrolase 1b, regulatory subunit 1a antikoerper, platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b antikoerper, PAFAH1B1 antikoerper, Pafah1b1 antikoerper, pafah1b1.L antikoerper, pafah1b1a antikoerper, pafah1b1b antikoerper

Hintergrund: This locus was identified as encoding a gene that when mutated or lost caused the lissencephaly associated with Miller-Dieker lissencephaly syndrome. PAFAH1B1 is the non-catalytic alpha subunit of the intracellular Ib isoform of platelet-activating factor acteylhydrolase, a heterotrimeric enzyme that specifically catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine).

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: M Phase, Regulation of Cell Size