-
- Target Alle RAD54L Antikörper anzeigen
- RAD54L (RAD54-Like (RAD54L))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RAD54L Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- RAD54 L antibody was raised using a synthetic peptide corresponding to a region with amino acids VVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDEIDQKLEGFMNQRGAR
- Top Product
- Discover our top product RAD54L Primärantikörper
-
anti-RAD54-Like (RAD54L) (C-Term) antibody
RAD54L Reaktivität: Human, Maus WB, ELISA, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-RAD54-Like (RAD54L) antibodyRAD54L Reaktivität: Human WB, IHC, IF, IC Wirt: Kaninchen Polyclonal unconjugated
anti-RAD54-Like (RAD54L) (AA 638-747) antibodyRAD54L Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-RAD54-Like (RAD54L) (AA 1-300), (C-Term), (N-Term) antibodyRAD54L Reaktivität: Human WB, ELISA, IHC, IHC (p) Wirt: Maus Monoclonal 60-1 unconjugated
anti-RAD54-Like (RAD54L) (N-Term) antibodyRAD54L Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-RAD54-Like (RAD54L) (AA 638-747) antibodyRAD54L Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 4G2 unconjugated
anti-RAD54-Like (RAD54L) (AA 216-265) antibodyRAD54L Reaktivität: Human, Pferd, Kaninchen, Rind (Kuh), Hund, Meerschweinchen, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-RAD54-Like (RAD54L) (AA 641-671), (C-Term) antibodyRAD54L Reaktivität: Human WB, FACS, EIA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RAD54L Blocking Peptide, catalog no. 33R-9897, is also available for use as a blocking control in assays to test for specificity of this RAD54L antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD50 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAD54L (RAD54-Like (RAD54L))
- Andere Bezeichnung
- RAD54L (RAD54L Produkte)
- Synonyme
- HR54 antikoerper, RAD54A antikoerper, hHR54 antikoerper, hRAD54 antikoerper, RAD54 antikoerper, zgc:56289 antikoerper, rad54l antikoerper, MGC69368 antikoerper, GdRAD54 antikoerper, RAD54-like antikoerper, RAD54L antikoerper, RAD54 like antikoerper, RAD54 like (S. cerevisiae) antikoerper, RAD54-like (S. cerevisiae) antikoerper, RAD54L antikoerper, Rad54l antikoerper, rad54l antikoerper
- Hintergrund
- This protein belongs to the DEAD-like helicase superfamily, and shares similarity with Saccharomyces cerevisiae Rad54, a protein known to be involved in the homologous recombination and repair of DNA. This protein has been shown to play a role in homologous recombination related repair of DNA double-strand breaks. The binding of this protein to double-strand DNA induces a DNA topological change, which is thought to facilitate homologous DNA paring, and stimulate DNA recombination.
- Molekulargewicht
- 84 kDa (MW of target protein)
- Pathways
- DNA Reparatur
-
Sie sind hier:
