RAD54L Antikörper

Produktnummer ABIN634218

Der Kaninchen Polyklonal anti-RAD54L Antikörper (ABIN634218) detektiert spezifisch RAD54L in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für RAD54L Antikörper (ABIN634218)

Target: RAD54L (RAD54-Like (RAD54L))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAD54L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RAD54L Antikörper

Aufreinigung: Affinity purified

Immunogen: RAD54 L antibody was raised using a synthetic peptide corresponding to a region with amino acids VVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDEIDQKLEGFMNQRGAR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAD54L Blocking Peptide, (ABIN5615736), is also available for use as a blocking control in assays to test for specificity of this RAD54L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD50 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAD54L

Target: RAD54L (RAD54-Like (RAD54L))

Andere Bezeichnung: RAD54L

Hintergrund: This protein belongs to the DEAD-like helicase superfamily, and shares similarity with Saccharomyces cerevisiae Rad54, a protein known to be involved in the homologous recombination and repair of DNA. This protein has been shown to play a role in homologous recombination related repair of DNA double-strand breaks. The binding of this protein to double-strand DNA induces a DNA topological change, which is thought to facilitate homologous DNA paring, and stimulate DNA recombination.

Molekulargewicht: 84 kDa (MW of target protein)

Pathways: DNA Reparatur