BUB3 Antikörper

Produktnummer ABIN634196

Produktdetails anti-BUB3 Antikörper

Target: BUB3 (Budding Uninhibited By Benzimidazoles 3 Homolog (Yeast) (BUB3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BUB3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: BUB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BUB3 Blocking Peptide, catalog no. 33R-6544, is also available for use as a blocking control in assays to test for specificity of this BUB3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BUB3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BUB3

Target: BUB3 (Budding Uninhibited By Benzimidazoles 3 Homolog (Yeast) (BUB3))

Andere Bezeichnung: BUB3 (BUB3 Produkte)

Synonyme: BUB3L antikoerper, hBUB3 antikoerper, Aa2-050 antikoerper, xbub3 antikoerper, AU019800 antikoerper, AU021329 antikoerper, AU043350 antikoerper, AW146323 antikoerper, C78067 antikoerper, BUB3, mitotic checkpoint protein antikoerper, BUB3 mitotic checkpoint protein antikoerper, BUB3 mitotic checkpoint protein L homeolog antikoerper, BUB3 antikoerper, Bub3 antikoerper, bub3.L antikoerper

Hintergrund: BUB3 is required for kinetochore localization of BUB1.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: Maintenance of Protein Location