UBE2C Antikörper (Middle Region)

Produktnummer ABIN634158

Der Kaninchen Polyklonal anti-UBE2C Antikörper (ABIN634158) detektiert spezifisch UBE2C in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für UBE2C Antikörper (Middle Region) (ABIN634158)

Target: UBE2C (Ubiquitin-Conjugating Enzyme E2C (UBE2C))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBE2C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-UBE2C Antikörper

Bindungsspezifität: Middle Region

Spezifität: UBE2 C antibody was raised against the middle region of UBE2

Aufreinigung: Affinity purified

Immunogen: UBE2 C antibody was raised using the middle region of UBE2 corresponding to a region with amino acids GTAVGSIRTSSTVCLLSGPRETQDSSKPLVWGLGWDMRLLLELTLQLFLQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UBE2C Blocking Peptide, (ABIN938987), is also available for use as a blocking control in assays to test for specificity of this UBE2C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBE2C

Target: UBE2C (Ubiquitin-Conjugating Enzyme E2C (UBE2C))

Andere Bezeichnung: UBE2C

Hintergrund: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2C is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for the destruction of mitotic cyclins and for cell cycle progression.

Molekulargewicht: 17 kDa (MW of target protein)

Pathways: Ubiquitin Proteasome Pathway