PPP2R3B Antikörper

Produktnummer ABIN634157

Produktdetails anti-PPP2R3B Antikörper

Target: PPP2R3B (Protein Phosphatase 2A 48 KDa Regulatory Subunit (PPP2R3B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPP2R3B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PPP2 R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPP2R3B Blocking Peptide, catalog no. 33R-9062, is also available for use as a blocking control in assays to test for specificity of this PPP2R3B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPP2R3B

Target: PPP2R3B (Protein Phosphatase 2A 48 KDa Regulatory Subunit (PPP2R3B))

Andere Bezeichnung: PPP2R3B (PPP2R3B Produkte)

Synonyme: NYREN8 antikoerper, PPP2R3L antikoerper, PPP2R3LY antikoerper, PR48 antikoerper, im:6895423 antikoerper, si:ch211-269e2.2 antikoerper, protein phosphatase 2 regulatory subunit B''beta antikoerper, serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta antikoerper, protein phosphatase 2, regulatory subunit B'', beta antikoerper, protein phosphatase 2 regulatory subunit B', beta L homeolog antikoerper, PPP2R3B antikoerper, LOC607103 antikoerper, ppp2r3b antikoerper, ppp2r3b.L antikoerper, Ppp2r3b antikoerper

Hintergrund: Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B.

Molekulargewicht: 65 kDa (MW of target protein)

Pathways: PI3K-Akt Signalweg, Mitotic G1-G1/S Phases