MLH3 Antikörper

Produktnummer ABIN634149

Produktdetails anti-MLH3 Antikörper

Target: MLH3 (MutL Homolog 3 (MLH3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MLH3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: MLH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SMQVLQQVDNKFIACLMSTKTEENGEADSYEKQQAQGSGRKKLLSSTLIP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MLH3 Blocking Peptide, catalog no. 33R-8644, is also available for use as a blocking control in assays to test for specificity of this MLH3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLH3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MLH3

Target: MLH3 (MutL Homolog 3 (MLH3))

Andere Bezeichnung: MLH3 (MLH3 Produkte)

Synonyme: AV125803 antikoerper, BB126472 antikoerper, MGC80774 antikoerper, MLH3 antikoerper, HNPCC7 antikoerper, mutL homolog 3 antikoerper, mutL homolog 3 L homeolog antikoerper, Mlh3 antikoerper, mlh3.L antikoerper, MLH3 antikoerper, mlh3 antikoerper

Hintergrund: This gene is a member of the MutL-homolog (MLH) family of DNA mismatch repair (MMR) genes. MLH genes are implicated in maintaining genomic integrity during DNA replication and after meiotic recombination. MLH3 functions as a heterodimer with other family members. Somatic mutations in this gene frequently occur in tumors exhibiting microsatellite instability, and germline mutations have been linked to hereditary nonpolyposis colorectal cancer type 7 (HNPCC7). Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined.

Molekulargewicht: 161 kDa (MW of target protein)

Pathways: Chromatin Binding