MSH5 Antikörper
-
- Target Alle MSH5 Antikörper anzeigen
- MSH5 (MutS Homolog 5 (MSH5))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MSH5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- MSH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KQRLLSGNYSFIPDAMTATEKILFLSSIIPFDCLLTPPGDLRFTPIPLLI
- Top Product
- Discover our top product MSH5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MSH5 Blocking Peptide, catalog no. 33R-4613, is also available for use as a blocking control in assays to test for specificity of this MSH5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSH5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MSH5 (MutS Homolog 5 (MSH5))
- Andere Bezeichnung
- MSH5 (MSH5 Produkte)
- Synonyme
- MSH5 antikoerper, G7 antikoerper, MUTSH5 antikoerper, NG23 antikoerper, Mut5 antikoerper, mutS homolog 5 antikoerper, mutS protein homolog 5 antikoerper, MSH (MutS Homolog) family antikoerper, MSH5 antikoerper, msh5 antikoerper, LOC100635155 antikoerper, Msh5 antikoerper, msh-5 antikoerper
- Hintergrund
- MSH5 is a member of the mutS family of proteins that are involved in DNA mismatch repair or meiotic recombination processes. This protein is similar to a Saccharomyces cerevisiae protein that participates in meiotic segregation fidelity and crossing-over.
- Molekulargewicht
- 95 kDa (MW of target protein)
- Pathways
- M Phase
-