MCM2 Antikörper (Middle Region)

Produktnummer ABIN634144

Produktdetails anti-MCM2 Antikörper

Target: MCM2 (Minichromosome Maintenance Complex Component 2 (MCM2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MCM2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MCM2 antibody was raised against the middle region of MCM2

Aufreinigung: Affinity purified

Immunogen: MCM2 antibody was raised using the middle region of MCM2 corresponding to a region with amino acids NNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MCM2 Blocking Peptide, catalog no. 33R-6804, is also available for use as a blocking control in assays to test for specificity of this MCM2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MCM2

Target: MCM2 (Minichromosome Maintenance Complex Component 2 (MCM2))

Andere Bezeichnung: MCM2 (MCM2 Produkte)

Synonyme: CG7538 antikoerper, DmMCM2 antikoerper, DmMcm2 antikoerper, DmeMCM2 antikoerper, Dmel\\CG7538 antikoerper, MCM2 antikoerper, MCM2-7 antikoerper, MCM2_DROME antikoerper, McM2 antikoerper, PCR3 antikoerper, dMCM2 antikoerper, l(3)rL074 antikoerper, XMcm2 antikoerper, bm28 antikoerper, ccnl1 antikoerper, cdc19 antikoerper, cdcl1 antikoerper, mitotin antikoerper, cb737 antikoerper, chunp6905 antikoerper, BM28 antikoerper, CCNL1 antikoerper, CDCL1 antikoerper, D3S3194 antikoerper, MITOTIN antikoerper, MCM7 antikoerper, AA959861 antikoerper, AW476101 antikoerper, Mcmd2 antikoerper, mKIAA0030 antikoerper, Minichromosome maintenance 2 antikoerper, minichromosome maintenance complex component 2 antikoerper, minichromosome maintenance complex component 2 L homeolog antikoerper, Mcm2 antikoerper, mcm2 antikoerper, MCM2 antikoerper, mcm2.L antikoerper

Hintergrund: This protein is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins.

Molekulargewicht: 102 kDa (MW of target protein)

Pathways: DNA Reparatur, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA