NCAPD2 Antikörper (C-Term)

Produktnummer ABIN634129

Produktdetails anti-NCAPD2 Antikörper

Target: NCAPD2 (Non-SMC Condensin I Complex, Subunit D2 (NCAPD2))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NCAPD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NCAPD2 antibody was raised against the C terminal of NCAPD2

Aufreinigung: Affinity purified

Immunogen: NCAPD2 antibody was raised using the C terminal of NCAPD2 corresponding to a region with amino acids KAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSTGSRYQPL

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NCAPD2 Blocking Peptide, catalog no. 33R-4246, is also available for use as a blocking control in assays to test for specificity of this NCAPD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCAPD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NCAPD2

Target: NCAPD2 (Non-SMC Condensin I Complex, Subunit D2 (NCAPD2))

Andere Bezeichnung: NCAPD2 (NCAPD2 Produkte)

Synonyme: CAP-D2 antikoerper, CNAP1 antikoerper, hCAP-D2 antikoerper, 2810406C15Rik antikoerper, 2810465G24Rik antikoerper, mKIAA0159 antikoerper, RGD1562596 antikoerper, im:6902697 antikoerper, si:dkey-175g20.1 antikoerper, wu:fc13f08 antikoerper, wu:fx06e10 antikoerper, non-SMC condensin I complex subunit D2 antikoerper, non-SMC condensin I complex, subunit D2 antikoerper, non-SMC condensin I complex subunit D2 S homeolog antikoerper, condensin complex subunit 1 antikoerper, NCAPD2 antikoerper, Ncapd2 antikoerper, ncapd2.S antikoerper, CIMG_02087 antikoerper, BDBG_08990 antikoerper, MCYG_08389 antikoerper, VDBG_09812 antikoerper, MGYG_05811 antikoerper, ncapd2 antikoerper

Hintergrund: NCAPD2 is the regulatory subunit of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases. NCAPD2 may target the condensin complex to DNA via its C-terminal domain.

Molekulargewicht: 157 kDa (MW of target protein)