RPA1 Antikörper (Middle Region)

Produktnummer ABIN634119

Produktdetails anti-RPA1 Antikörper

Target: RPA1 (Replication Protein A1, 70kDa (RPA1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RPA1 antibody was raised against the middle region of RPA1

Aufreinigung: Affinity purified

Immunogen: RPA1 antibody was raised using the middle region of RPA1 corresponding to a region with amino acids TLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPA1 Blocking Peptide, catalog no. 33R-9194, is also available for use as a blocking control in assays to test for specificity of this RPA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPA1

Target: RPA1 (Replication Protein A1, 70kDa (RPA1))

Andere Bezeichnung: RPA1 (RPA1 Produkte)

Synonyme: HSSB antikoerper, MST075 antikoerper, REPA1 antikoerper, RF-A antikoerper, RP-A antikoerper, RPA70 antikoerper, Cb1-727 antikoerper, wu:fi14b08 antikoerper, zgc:55337 antikoerper, zgc:77092 antikoerper, RPA1 antikoerper, hssb antikoerper, mst075 antikoerper, repa1 antikoerper, rf-a antikoerper, rp-a antikoerper, rpa antikoerper, rpa70 antikoerper, LOC100230990 antikoerper, 5031405K23Rik antikoerper, 70kDa antikoerper, AA589576 antikoerper, AW557552 antikoerper, Rpa antikoerper, CG9633 antikoerper, D-RPA70 antikoerper, D-SSB antikoerper, DRP-A antikoerper, DmRPA antikoerper, Dmel\\CG9633 antikoerper, RPA antikoerper, RPA 70 antikoerper, RPA 70 kDa antikoerper, RpA70 antikoerper, Rpa-70 antikoerper, Ssb-70 antikoerper, dRP-A antikoerper, dmrpa1 antikoerper, i164 antikoerper, replication protein A1 antikoerper, replication protein A1, 70kDa antikoerper, replication protein A1 L homeolog antikoerper, Replication Protein A 70 antikoerper, RPA1 antikoerper, Rpa1 antikoerper, rpa1 antikoerper, rpa1.L antikoerper, RpA-70 antikoerper

Hintergrund: RPA1 plays an essential role in several cellular processes in DNA metabolism including replication, recombination and DNA repair.

Molekulargewicht: 68 kDa (MW of target protein)

Pathways: Telomere Maintenance, DNA Reparatur, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA