XRCC2 Antikörper (Middle Region)

Produktnummer ABIN634115

Produktdetails anti-XRCC2 Antikörper

Target: XRCC2 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser XRCC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: XRCC2 antibody was raised against the middle region of XRCC2

Aufreinigung: Affinity purified

Immunogen: XRCC2 antibody was raised using the middle region of XRCC2 corresponding to a region with amino acids CLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

XRCC2 Blocking Peptide, catalog no. 33R-1740, is also available for use as a blocking control in assays to test for specificity of this XRCC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XRCC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu XRCC2

Target: XRCC2 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC2))

Andere Bezeichnung: XRCC2 (XRCC2 Produkte)

Synonyme: XRCC2 antikoerper, 4921524O04Rik antikoerper, 8030409M04Rik antikoerper, RAD51 antikoerper, RecA antikoerper, RGD1564823 antikoerper, X-ray repair cross complementing 2 antikoerper, X-ray repair complementing defective repair in Chinese hamster cells 2 antikoerper, XRCC2 antikoerper, Xrcc2 antikoerper

Hintergrund: XRCC2 is a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombination and it functionally complements Chinese hamster irs1, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents.

Molekulargewicht: 31 kDa (MW of target protein)

Pathways: DNA Reparatur