MCM3 Antikörper (C-Term)

Produktnummer ABIN634088

Produktdetails anti-MCM3 Antikörper

Target: MCM3 (Minichromosome Maintenance Complex Component 3 (MCM3))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MCM3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: MCM3 antibody was raised against the C terminal of MCM3

Aufreinigung: Affinity purified

Immunogen: MCM3 antibody was raised using the C terminal of MCM3 corresponding to a region with amino acids SQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQVHTPKTADSQE

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MCM3 Blocking Peptide, catalog no. 33R-8710, is also available for use as a blocking control in assays to test for specificity of this MCM3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MCM3

Target: MCM3 (Minichromosome Maintenance Complex Component 3 (MCM3))

Andere Bezeichnung: MCM3 (MCM3 Produkte)

Synonyme: HCC5 antikoerper, P1-MCM3 antikoerper, P1.h antikoerper, RLFB antikoerper, AL033361 antikoerper, C80350 antikoerper, Mcmd antikoerper, P1 antikoerper, p1.m antikoerper, cb32 antikoerper, chunp6867 antikoerper, wu:fa26g03 antikoerper, CG4206 antikoerper, DmMCM3 antikoerper, DmMcm3 antikoerper, DmeMCM3 antikoerper, Dmel\\CG4206 antikoerper, MCM3 antikoerper, McM3 antikoerper, Mcp-PCR2 antikoerper, PCR2 antikoerper, dMCM3 antikoerper, xmcm3 antikoerper, minichromosome maintenance complex component 3 antikoerper, MCM3 minichromosome maintenance deficient 3 (S. cerevisiae) antikoerper, Minichromosome maintenance 3 antikoerper, minichromosome maintenance complex component 3 L homeolog antikoerper, MCM complex subunit Mcm3 antikoerper, MCM3 antikoerper, mcm3 antikoerper, Mcm3 antikoerper, mcm3.L antikoerper

Hintergrund: MCM3 is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression.

Molekulargewicht: 89 kDa (MW of target protein)

Pathways: DNA Reparatur, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA