KPNA2 Antikörper
-
- Target Alle KPNA2 Antikörper anzeigen
- KPNA2 (Karyopherin alpha 2 (RAG Cohort 1, Importin alpha 1) (KPNA2))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KPNA2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Karyopherin Alpha 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ
- Top Product
- Discover our top product KPNA2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Karyopherin Alpha 2 Blocking Peptide, catalog no. 33R-3602, is also available for use as a blocking control in assays to test for specificity of this Karyopherin Alpha 2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KPNA2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KPNA2 (Karyopherin alpha 2 (RAG Cohort 1, Importin alpha 1) (KPNA2))
- Andere Bezeichnung
- Karyopherin alpha 2 (KPNA2 Produkte)
- Synonyme
- IPOA1 antikoerper, QIP2 antikoerper, RCH1 antikoerper, SRP1alpha antikoerper, ima2 antikoerper, importin antikoerper, 2410044B12Rik antikoerper, PTAC58 antikoerper, Rch1 antikoerper, ipoa1 antikoerper, kpna2 antikoerper, qip2 antikoerper, rch1 antikoerper, srp1alpha antikoerper, hm:zeh0389 antikoerper, hm:zeh0389r antikoerper, zgc:113902 antikoerper, zgc:86945 antikoerper, karyopherin subunit alpha 2 antikoerper, importin subunit alpha-2 antikoerper, Importin subunit alpha-2 antikoerper, karyopherin (importin) alpha 2 antikoerper, karyopherin alpha-2 subunit like L homeolog antikoerper, karyopherin alpha 2 (RAG cohort 1, importin alpha 1) antikoerper, KPNA2 antikoerper, EDI_246290 antikoerper, EDI_335040 antikoerper, ima2 antikoerper, Kpna2 antikoerper, kpna2.L antikoerper, kpna2 antikoerper
- Hintergrund
- Imported proteins require a nuclear localization sequence (NLS) which generally consists of a short region of basic amino acids or 2 such regions spaced about 10 amino acids apart. Proteins involved in the first step of nuclear import have been identified in different systems. These include the Xenopus protein importin and its yeast homolog, SRP1 (a suppressor of certain temperature-sensitive mutations of RNA polymerase I in Saccharomyces cerevisiae), which bind to the NLS. KPNA2 protein interacts with the NLSs of DNA helicase Q1 and SV40 T antigen and may be involved in the nuclear transport of proteins.
- Molekulargewicht
- 58 kDa (MW of target protein)
- Pathways
- M Phase, Protein targeting to Nucleus
-