PCSK1 Antikörper (Middle Region)

Produktnummer ABIN633993

Produktdetails anti-PCSK1 Antikörper

Target: PCSK1 (Proprotein Convertase Subtilisin/kexin Type 1 (PCSK1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCSK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PCSK1 antibody was raised against the middle region of PCSK1

Aufreinigung: Affinity purified

Immunogen: PCSK1 antibody was raised using the middle region of PCSK1 corresponding to a region with amino acids QSPKKSPSAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCSK1 Blocking Peptide, catalog no. 33R-7733, is also available for use as a blocking control in assays to test for specificity of this PCSK1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCSK1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCSK1

Target: PCSK1 (Proprotein Convertase Subtilisin/kexin Type 1 (PCSK1))

Andere Bezeichnung: PCSK1 (PCSK1 Produkte)

Synonyme: BMIQ12 antikoerper, NEC1 antikoerper, PC1 antikoerper, PC3 antikoerper, SPC3 antikoerper, Nec-1 antikoerper, Nec1 antikoerper, Phpp-1 antikoerper, BDP antikoerper, PC1/3 antikoerper, proprotein convertase subtilisin/kexin type 1 antikoerper, prohormone convertase 1 antikoerper, PCSK1 antikoerper, Pcsk1 antikoerper, pcsk1 antikoerper, PC1B antikoerper

Hintergrund: PCSK1 is involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Substrates include POMC, renin, enkephalin, dynorphin, somatostatin and insulin.

Molekulargewicht: 71 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism