CPN1 Antikörper (Middle Region)

Produktnummer ABIN633971

Produktdetails anti-CPN1 Antikörper

Target: CPN1 (Carboxypeptidase N Subunit 1 (CPN1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CPN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Carboxypeptidase N1 antibody was raised against the middle region of CPN1

Aufreinigung: Affinity purified

Immunogen: Carboxypeptidase N1 antibody was raised using the middle region of CPN1 corresponding to a region with amino acids FQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Carboxypeptidase N1 Blocking Peptide, catalog no. 33R-3033, is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase N1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CPN1

Target: CPN1 (Carboxypeptidase N Subunit 1 (CPN1))

Andere Bezeichnung: Carboxypeptidase N1 (CPN1 Produkte)

Synonyme: CPN antikoerper, SCPN antikoerper, Cpn antikoerper, cb1037 antikoerper, fa99g08 antikoerper, wu:fa99g08 antikoerper, zgc:77485 antikoerper, cpn antikoerper, scpn antikoerper, 0610011F20Rik antikoerper, carboxypeptidase N subunit 1 antikoerper, carboxypeptidase N, polypeptide 1 antikoerper, carboxypeptidase N subunit 1 S homeolog antikoerper, CPN1 antikoerper, Cpn1 antikoerper, cpn1 antikoerper, cpn1.S antikoerper

Hintergrund: Carboxypeptidase N is a plasma metallo-protease that cleaves basic amino acids from the C terminal of peptides and proteins. The enzyme is important in the regulation of peptides like kinins and anaphylatoxins, and has also been known as kininase-1 and anaphylatoxin inactivator. This enzyme is a tetramer comprised of two identical regulatory subunits and two identical catalytic subunits, this gene encodes the catalytic subunit. Mutations in this gene can be associated with angioedema or chronic urticaria resulting from carboxypeptidase N deficiency.

Molekulargewicht: 50 kDa (MW of target protein)

Pathways: Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis, Peptide Hormone Metabolism, Regulation of Systemic Arterial Blood Pressure by Hormones, C21-Steroid Hormone Metabolic Process