PYCR1 Antikörper (Middle Region)

Produktnummer ABIN633951

Produktdetails anti-PYCR1 Antikörper

Target: PYCR1 (Pyrroline-5-Carboxylate Reductase 1 (PYCR1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PYCR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PYCR1 antibody was raised against the middle region of PYCR1

Aufreinigung: Affinity purified

Immunogen: PYCR1 antibody was raised using the middle region of PYCR1 corresponding to a region with amino acids RSLLINAVEASCIRTRELQSMADQEQVSPAAIKKTILDKDHLPLELGSPE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PYCR1 Blocking Peptide, catalog no. 33R-8196, is also available for use as a blocking control in assays to test for specificity of this PYCR1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PYCR1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PYCR1

Target: PYCR1 (Pyrroline-5-Carboxylate Reductase 1 (PYCR1))

Andere Bezeichnung: PYCR1 (PYCR1 Produkte)

Synonyme: arcl2b antikoerper, p5c antikoerper, p5cr antikoerper, pig45 antikoerper, pp222 antikoerper, pro3 antikoerper, pycr antikoerper, ARCL2B antikoerper, ARCL3B antikoerper, P5C antikoerper, P5CR antikoerper, PIG45 antikoerper, PP222 antikoerper, PRO3 antikoerper, PYCR antikoerper, zgc:73112 antikoerper, pyrroline-5-carboxylate reductase family, member 1 L homeolog antikoerper, pyrroline-5-carboxylate reductase 1 antikoerper, pyrroline-5-carboxylate reductase 1a antikoerper, pycr1.L antikoerper, PYCR1 antikoerper, Pycr1 antikoerper, pycr1a antikoerper

Hintergrund: This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types.

Molekulargewicht: 33 kDa (MW of target protein)