CPB2 Antikörper

Produktnummer ABIN633937

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch CPB2 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für CPB2 Antikörper (ABIN633937)

Target: CPB2 (Carboxypeptidase B2 (Plasma) (CPB2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CPB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CPB2 Antikörper

Aufreinigung: Affinity purified

Immunogen: Carboxypeptidase B2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Carboxypeptidase B2 Blocking Peptide, (ABIN5612617), is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase B2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CPB2

Target: CPB2 (Carboxypeptidase B2 (Plasma) (CPB2))

Andere Bezeichnung: Carboxypeptidase B2

Hintergrund: Carboxypeptidases are enzymes that hydrolyze C-terminal peptide bonds. The carboxypeptidase family includes metallo-, serine, and cysteine carboxypeptidases. According to their substrate specificity, these enzymes are referred to as carboxypeptidase A (cleaving aliphatic residues) or carboxypeptidase B (cleaving basic amino residues). CPB2 is activated by trypsin and acts on carboxypeptidase B substrates. After thrombin activation, the mature protein downregulates fibrinolysis.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization, Carbohydrate Homeostasis