CPB2 Antikörper

Produktnummer ABIN633937

Produktdetails anti-CPB2 Antikörper

Target: CPB2 (Carboxypeptidase B2 (Plasma) (CPB2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CPB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Carboxypeptidase B2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Carboxypeptidase B2 Blocking Peptide, catalog no. 33R-8190, is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase B2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CPB2

Target: CPB2 (Carboxypeptidase B2 (Plasma) (CPB2))

Andere Bezeichnung: Carboxypeptidase B2 (CPB2 Produkte)

Synonyme: CPU antikoerper, PCPB antikoerper, TAFI antikoerper, 1110032P04Rik antikoerper, 4930405E17Rik antikoerper, AI255929 antikoerper, CPR antikoerper, Cpu antikoerper, pCPB antikoerper, zgc:112493 antikoerper, carboxypeptidase B2 antikoerper, carboxypeptidase B2 (plasma) antikoerper, CPB2 antikoerper, Cpb2 antikoerper, cpb2 antikoerper

Hintergrund: Carboxypeptidases are enzymes that hydrolyze C-terminal peptide bonds. The carboxypeptidase family includes metallo-, serine, and cysteine carboxypeptidases. According to their substrate specificity, these enzymes are referred to as carboxypeptidase A (cleaving aliphatic residues) or carboxypeptidase B (cleaving basic amino residues). CPB2 is activated by trypsin and acts on carboxypeptidase B substrates. After thrombin activation, the mature protein downregulates fibrinolysis.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization, Carbohydrate Homeostasis