CHI3L1 Antikörper

Produktnummer ABIN633931

Produktdetails anti-CHI3L1 Antikörper

Target: CHI3L1 (Chitinase 3-Like 1 (Cartilage Glycoprotein-39) (CHI3L1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHI3L1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: CHI3 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHI3L1 Blocking Peptide, catalog no. 33R-4844, is also available for use as a blocking control in assays to test for specificity of this CHI3L1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHI0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHI3L1

Target: CHI3L1 (Chitinase 3-Like 1 (Cartilage Glycoprotein-39) (CHI3L1))

Andere Bezeichnung: CHI3L1 (CHI3L1 Produkte)

Synonyme: AW208766 antikoerper, Brp39 antikoerper, Gp39 antikoerper, ASRT7 antikoerper, CGP-39 antikoerper, GP-39 antikoerper, GP39 antikoerper, HC-gp39 antikoerper, HCGP-3P antikoerper, YKL-40 antikoerper, YKL40 antikoerper, YYL-40 antikoerper, hCGP-39 antikoerper, GP38K antikoerper, CLP-1 antikoerper, SPC-40 antikoerper, SPS-40 antikoerper, Chil1 antikoerper, BP40 antikoerper, MGP-40 antikoerper, chitinase-like 1 antikoerper, chitinase 3 like 1 antikoerper, chitinase 3-like 1 (cartilage glycoprotein-39) antikoerper, Chil1 antikoerper, CHI3L1 antikoerper, Chi3l1 antikoerper

Substanzklasse: Viral Protein

Hintergrund: CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment. CHI3L1 may play a role in tissue remodeling and defense against pathogens. It belongs to the glycosyl hydrolase 18 family. CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment.

Molekulargewicht: 42 kDa (MW of target protein)