EPHX1 Antikörper

Produktnummer ABIN633927

Der Kaninchen Polyklonal anti-EPHX1 Antikörper (ABIN633927) detektiert spezifisch EPHX1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für EPHX1 Antikörper (ABIN633927)

Target: EPHX1 (Epoxide Hydrolase 1, Microsomal (Xenobiotic) (EPHX1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EPHX1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EPHX1 Antikörper

Aufreinigung: Affinity purified

Immunogen: EPHX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EPHX1 Blocking Peptide, (ABIN938858), is also available for use as a blocking control in assays to test for specificity of this EPHX1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPHX1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EPHX1

Target: EPHX1 (Epoxide Hydrolase 1, Microsomal (Xenobiotic) (EPHX1))

Andere Bezeichnung: EPHX1

Hintergrund: Epoxide hydrolase is a critical biotransformation enzyme that converts epoxides from the degradation of aromatic compounds to trans-dihydrodiols which can be conjugated and excreted from the body. Epoxide hydrolase functions in both the activation and detoxification of epoxides. Mutations in this gene cause preeclampsia, epoxide hydrolase deficiency or increased epoxide hydrolase activity.

Molekulargewicht: 53 kDa (MW of target protein)