EPHX1 Antikörper

Produktnummer ABIN633927

Produktdetails anti-EPHX1 Antikörper

Target: EPHX1 (Epoxide Hydrolase 1, Microsomal (Xenobiotic) (EPHX1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EPHX1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: EPHX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EPHX1 Blocking Peptide, catalog no. 33R-3472, is also available for use as a blocking control in assays to test for specificity of this EPHX1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPHX1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EPHX1

Target: EPHX1 (Epoxide Hydrolase 1, Microsomal (Xenobiotic) (EPHX1))

Andere Bezeichnung: EPHX1 (EPHX1 Produkte)

Synonyme: NV13267 antikoerper, DRB1 antikoerper, DSRNA-BINDING PROTEIN 1 antikoerper, F21M12.9 antikoerper, F21M12_9 antikoerper, HYPONASTIC LEAVES 1 antikoerper, AI195553 antikoerper, Eph-1 antikoerper, Eph1 antikoerper, mEH antikoerper, EPHX antikoerper, EPOX antikoerper, HYL1 antikoerper, MEH antikoerper, zgc:56126 antikoerper, ephx antikoerper, epox antikoerper, meh antikoerper, MEH8 antikoerper, epoxide hydrolase 1 antikoerper, epoxide hydrolase 1, microsomal (xenobiotic) antikoerper, Epoxide hydrolase 1 antikoerper, dsRNA-binding domain-like superfamily protein antikoerper, epoxide hydrolase 1, microsomal antikoerper, epoxide hydrolase 1, microsomal (xenobiotic) L homeolog antikoerper, EPHX1 antikoerper, Eh1 antikoerper, hyep antikoerper, HYL1 antikoerper, Ephx1 antikoerper, ephx1 antikoerper, ephx1.L antikoerper

Hintergrund: Epoxide hydrolase is a critical biotransformation enzyme that converts epoxides from the degradation of aromatic compounds to trans-dihydrodiols which can be conjugated and excreted from the body. Epoxide hydrolase functions in both the activation and detoxification of epoxides. Mutations in this gene cause preeclampsia, epoxide hydrolase deficiency or increased epoxide hydrolase activity.

Molekulargewicht: 53 kDa (MW of target protein)