Chromogranin A Antikörper
-
- Target Alle Chromogranin A (CHGA) Antikörper anzeigen
- Chromogranin A (CHGA)
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Chromogranin A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Chromogranin A antibody was raised using a synthetic peptide corresponding to a region with amino acids DSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQ
- Top Product
- Discover our top product CHGA Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Chromogranin A Blocking Peptide, catalog no. 33R-2167, is also available for use as a blocking control in assays to test for specificity of this Chromogranin A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHGA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Chromogranin A (CHGA)
- Andere Bezeichnung
- Chromogranin A (CHGA Produkte)
- Synonyme
- CGA antikoerper, CG-ALPHA antikoerper, FSHA antikoerper, GPHA1 antikoerper, GPHa antikoerper, HCG antikoerper, LHA antikoerper, TSHA antikoerper, ChrA antikoerper, fj05f09 antikoerper, si:dkey-177p2.2 antikoerper, wu:fj05f09 antikoerper, zgc:101749 antikoerper, zgc:56075 antikoerper, CHGA antikoerper, cgA antikoerper, chga antikoerper, chromogranin A antikoerper, glycoprotein hormones, alpha polypeptide antikoerper, uncharacterized CHGA antikoerper, chromogranin A S homeolog antikoerper, CHGA antikoerper, CGA antikoerper, Chga antikoerper, chga antikoerper, chga.S antikoerper
- Hintergrund
- CHGA is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells. Its gene product is a precursor to three biologically active peptides, vasostatin, pancreastatin, and parastatin. These peptides act as autocrine or paracrine negative modulators of the neuroendocrine system. Other peptides, including chromostatin, beta-granin, WE-14 and GE-25, are also derived from the full-length protein. However, biological activities for these molecules have not been shown.
- Molekulargewicht
- 51 kDa (MW of target protein)
- Pathways
- Negative Regulation of Hormone Secretion, cAMP Metabolic Process, Regulation of G-Protein Coupled Receptor Protein Signaling
-