CYP2C9 Antikörper (C-Term)

Produktnummer ABIN633894

Produktdetails anti-CYP2C9 Antikörper

Target: CYP2C9 (Cytochrome P450, Family 2, Subfamily C, Polypeptide 9 (CYP2C9))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYP2C9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CYP2 C9 antibody was raised against the C terminal of CYP2 9

Aufreinigung: Affinity purified

Immunogen: CYP2 C9 antibody was raised using the C terminal of CYP2 9 corresponding to a region with amino acids AGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVPPFYQLCFIPV

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CYP2C9 Blocking Peptide, catalog no. 33R-1211, is also available for use as a blocking control in assays to test for specificity of this CYP2C9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CYP2C9

Target: CYP2C9 (Cytochrome P450, Family 2, Subfamily C, Polypeptide 9 (CYP2C9))

Andere Bezeichnung: CYP2C9 (CYP2C9 Produkte)

Synonyme: CPC9 antikoerper, CYP2C antikoerper, CYP2C10 antikoerper, CYPIIC9 antikoerper, P450IIC9 antikoerper, cytochrome P450 family 2 subfamily C member 9 antikoerper, CYP2C9 antikoerper

Hintergrund: CYP2C9 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by rifampin. The enzyme is known to metabolize many xenobiotics, including phenytoin, tolbutamide, ibuprofen and S-warfarin. Studies identifying individuals who are poor metabolizers of phenytoin and tolbutamide suggest that CYP2C9 gene is polymorphic.

Molekulargewicht: 55 kDa (MW of target protein)