SPINK1 Antikörper (N-Term)

Produktnummer ABIN633881

Produktdetails anti-SPINK1 Antikörper

Target: SPINK1 (serine Peptidase Inhibitor, Kazal Type 1 (SPINK1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SPINK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SPINK1 antibody was raised against the N terminal of SPINK1

Aufreinigung: Affinity purified

Immunogen: SPINK1 antibody was raised using the N terminal of SPINK1 corresponding to a region with amino acids KVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SPINK1 Blocking Peptide, catalog no. 33R-4724, is also available for use as a blocking control in assays to test for specificity of this SPINK1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPINK1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SPINK1

Target: SPINK1 (serine Peptidase Inhibitor, Kazal Type 1 (SPINK1))

Andere Bezeichnung: SPINK1 (SPINK1 Produkte)

Synonyme: PCTT antikoerper, PSTI antikoerper, Spink3 antikoerper, TATI antikoerper, TCP antikoerper, Psti antikoerper, SPINK1 antikoerper, p12 antikoerper, serine peptidase inhibitor, Kazal type 1 antikoerper, SPINK1 antikoerper, Spink1 antikoerper

Hintergrund: SPINK1 is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis.

Molekulargewicht: 8 kDa (MW of target protein)