WNT5B Antikörper (Middle Region)
-
- Target Alle WNT5B Antikörper anzeigen
- WNT5B (Wingless-Type MMTV Integration Site Family, Member 5B (WNT5B))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser WNT5B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- WNT5 B antibody was raised against the middle region of WNT5
- Aufreinigung
- Affinity purified
- Immunogen
- WNT5 B antibody was raised using the middle region of WNT5 corresponding to a region with amino acids YCLRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHC
- Top Product
- Discover our top product WNT5B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
WNT5B Blocking Peptide, catalog no. 33R-10059, is also available for use as a blocking control in assays to test for specificity of this WNT5B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WNT5B (Wingless-Type MMTV Integration Site Family, Member 5B (WNT5B))
- Andere Bezeichnung
- WNT5B (WNT5B Produkte)
- Synonyme
- wnt-5b antikoerper, xwnt5b antikoerper, WNT5B antikoerper, AW545702 antikoerper, Wnt-5b antikoerper, xwnt-5c antikoerper, CHUNP6928 antikoerper, id:ibd5111 antikoerper, ppt antikoerper, wnt-5 antikoerper, wnt5 antikoerper, wnt[b] antikoerper, wu:fk85g06 antikoerper, Wnt family member 5B antikoerper, wingless-type MMTV integration site family, member 5B antikoerper, Wnt family member 5B S homeolog antikoerper, wingless-type MMTV integration site family, member 5b antikoerper, wnt5b antikoerper, WNT5B antikoerper, Wnt5b antikoerper, wnt5b.S antikoerper
- Hintergrund
- The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes.
- Molekulargewicht
- 39 kDa (MW of target protein)
- Pathways
- WNT Signalweg, Embryonic Body Morphogenesis, Positive Regulation of fat Cell Differentiation
-