WNT3A Antikörper (N-Term)

Produktnummer ABIN633857

Produktdetails anti-WNT3A Antikörper

Target: WNT3A (Wingless-Type MMTV Integration Site Family, Member 3A (WNT3A))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WNT3A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WNT3 A antibody was raised against the N terminal of WNT3

Aufreinigung: Affinity purified

Immunogen: WNT3 A antibody was raised using the N terminal of WNT3 corresponding to a region with amino acids MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WNT3A Blocking Peptide, catalog no. 33R-5711, is also available for use as a blocking control in assays to test for specificity of this WNT3A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WNT3A

Target: WNT3A (Wingless-Type MMTV Integration Site Family, Member 3A (WNT3A))

Andere Bezeichnung: WNT3A (WNT3A Produkte)

Synonyme: WNT3A antikoerper, Wnt-3a antikoerper, vt antikoerper, Zwnt[a] antikoerper, wnt3 antikoerper, wnt3 l antikoerper, wnt3l antikoerper, wnt[a] antikoerper, Xwnt-3a antikoerper, wnt-3a antikoerper, wnt3a-A antikoerper, xwnt3a antikoerper, WNT-3A antikoerper, WNT3 antikoerper, wingless-type MMTV integration site family, member 3A antikoerper, Wnt family member 3A antikoerper, wingless-type MMTV integration site family member 3A L homeolog antikoerper, WNT3A antikoerper, Wnt3a antikoerper, wnt3a antikoerper, wnt3a.L antikoerper

Hintergrund: The WNT gene family consists of structurally related genes which encode secreted signaling proteins.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: WNT Signalweg, Regulation of Muscle Cell Differentiation, Regulation of Cell Size, Positive Regulation of Endopeptidase Activity