Angiopoietin 4 Antikörper (N-Term)
-
- Target Alle Angiopoietin 4 (ANGPT4) Antikörper anzeigen
- Angiopoietin 4 (ANGPT4)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Angiopoietin 4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ANGPT4 antibody was raised against the N terminal of ANGPT4
- Aufreinigung
- Affinity purified
- Immunogen
- ANGPT4 antibody was raised using the N terminal of ANGPT4 corresponding to a region with amino acids TLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPT
- Top Product
- Discover our top product ANGPT4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ANGPT4 Blocking Peptide, catalog no. 33R-9193, is also available for use as a blocking control in assays to test for specificity of this ANGPT4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANGPT4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Angiopoietin 4 (ANGPT4)
- Andere Bezeichnung
- ANGPT4 (ANGPT4 Produkte)
- Synonyme
- AGP4 antikoerper, ANG-3 antikoerper, ANG4 antikoerper, Agpt4 antikoerper, Ang3 antikoerper, ANGPT4 antikoerper, agp4 antikoerper, ang4 antikoerper, ANGPTL4 antikoerper, angiopoietin 4 antikoerper, angiopoietin-4 antikoerper, angiopoietin 4 S homeolog antikoerper, ANGPT4 antikoerper, Angpt4 antikoerper, angpt4 antikoerper, CpipJ_CPIJ008143 antikoerper, CpipJ_CPIJ016367 antikoerper, angpt4.S antikoerper, LOC100714243 antikoerper
- Hintergrund
- Angiopoietins are proteins with important roles in vascular development and angiogenesis. All angiopoietins bind with similar affinity to an endothelial cell-specific tyrosine-protein kinase receptor.
- Molekulargewicht
- 57 kDa (MW of target protein)
- Pathways
- RTK Signalweg
-