GNAO1 Antikörper (Middle Region)

Produktnummer ABIN633809

Produktdetails anti-GNAO1 Antikörper

Target: GNAO1 (Guanine Nucleotide Binding Protein (G Protein), alpha Activating Activity Polypeptide O (GNAO1))

Bindungsspezifität: Middle Region

Reaktivität: Maus, Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GNAO1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GNAO1 antibody was raised against the middle region of Gnao1

Aufreinigung: Affinity purified

Immunogen: GNAO1 antibody was raised using the middle region of Gnao1 corresponding to a region with amino acids CDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GNAO1 Blocking Peptide, catalog no. 33R-1672, is also available for use as a blocking control in assays to test for specificity of this GNAO1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAO1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GNAO1

Target: GNAO1 (Guanine Nucleotide Binding Protein (G Protein), alpha Activating Activity Polypeptide O (GNAO1))

Andere Bezeichnung: GNAO1 (GNAO1 Produkte)

Synonyme: G-ALPHA-o antikoerper, GNAO antikoerper, AW050213 antikoerper, Galphao antikoerper, Gnao antikoerper, alphaO antikoerper, gnao1 antikoerper, wu:fq26h05 antikoerper, zgc:73315 antikoerper, RATBPGTPC antikoerper, XGalpha01 antikoerper, gnao1-A antikoerper, zgc:73153 antikoerper, G protein subunit alpha o1 antikoerper, guanine nucleotide binding protein, alpha O antikoerper, guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O, a antikoerper, G protein subunit alpha o1 L homeolog antikoerper, Guanine nucleotide-binding protein G(o) subunit alpha antikoerper, guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O, b antikoerper, GNAO1 antikoerper, Gnao1 antikoerper, gnao1a antikoerper, gnao1.L antikoerper, goa-1 antikoerper, gnao1b antikoerper

Hintergrund: Activated Goalpha interacted directly with PLZF, and enhanced its function as a transcriptional and cell growth suppressor. Goalpha might play a role in mediating extracellular signal-regulated kinase activation by G protein-coupled receptors in the brain.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: G-protein mediated Events