DPYSL2 Antikörper (Middle Region)

Produktnummer ABIN633807

Produktdetails anti-DPYSL2 Antikörper

Target: DPYSL2 (Dihydropyrimidinase-Like 2 (DPYSL2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DPYSL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DPYSL2 antibody was raised against the middle region of DPYSL2

Aufreinigung: Affinity purified

Immunogen: DPYSL2 antibody was raised using the middle region of DPYSL2 corresponding to a region with amino acids NIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DPYSL2 Blocking Peptide, catalog no. 33R-6719, is also available for use as a blocking control in assays to test for specificity of this DPYSL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPYSL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DPYSL2

Target: DPYSL2 (Dihydropyrimidinase-Like 2 (DPYSL2))

Andere Bezeichnung: DPYSL2 (DPYSL2 Produkte)

Synonyme: CRMP-2 antikoerper, CRMP2 antikoerper, DHPRP2 antikoerper, DRP-2 antikoerper, DRP2 antikoerper, N2A3 antikoerper, ULIP-2 antikoerper, ULIP2 antikoerper, TOAD-64 antikoerper, crmp2 antikoerper, dhprp2 antikoerper, drp-2 antikoerper, drp2 antikoerper, unc-33 antikoerper, unc33 antikoerper, dpysl2 antikoerper, CRMP 2 antikoerper, PCRMP 2 antikoerper, PCRMP-2 antikoerper, PCRMP2 antikoerper, PfCRMP 2 antikoerper, PfCRMP-2 antikoerper, AI851130 antikoerper, Crmp2 antikoerper, Musunc33 antikoerper, Ulip2 antikoerper, CRMP2A antikoerper, dihydropyrimidinase like 2 antikoerper, dihydropyrimidinase-like 2 antikoerper, dihydropyrimidinase like 2 L homeolog antikoerper, dihydropyrimidinase-like 2b antikoerper, cysteine repeat modular protein 2, putative antikoerper, DPYSL2 antikoerper, dpysl2.L antikoerper, dpysl2b antikoerper, PfCRMP2 antikoerper, dpysl2 antikoerper, Dpysl2 antikoerper

Hintergrund: DPYSL2 belongs to the DHOase family. It is necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. The protein plays a role in axon guidance, neuronal growth cone collapse and cell migration.

Molekulargewicht: 62 kDa (MW of target protein)

Pathways: Regulation of Cell Size