SCN3B Antikörper (N-Term)
-
- Target Alle SCN3B Antikörper anzeigen
- SCN3B (Sodium Channel, Voltage-Gated, Type III, beta Subunit (SCN3B))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Ratte, Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SCN3B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SCN3 B antibody was raised against the N terminal of SCN3
- Aufreinigung
- Affinity purified
- Immunogen
- SCN3 B antibody was raised using the N terminal of SCN3 corresponding to a region with amino acids RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLND
- Top Product
- Discover our top product SCN3B Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SCN3B Blocking Peptide, catalog no. 33R-8090, is also available for use as a blocking control in assays to test for specificity of this SCN3B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCN0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SCN3B (Sodium Channel, Voltage-Gated, Type III, beta Subunit (SCN3B))
- Andere Bezeichnung
- SCN3B (SCN3B Produkte)
- Synonyme
- 1110001K16Rik antikoerper, 4833414B02Rik antikoerper, Scnb3 antikoerper, HSA243396 antikoerper, SCNB3 antikoerper, sodium voltage-gated channel beta subunit 3 antikoerper, sodium channel, voltage-gated, type III, beta antikoerper, SCN3B antikoerper, Scn3b antikoerper
- Hintergrund
- SCN3B is one member of the sodium channel beta subunits of voltage-gated sodium channels, which are responsible for the generation and propagation of action potentials in neurons and muscle. SCN3B influences the inactivation kinetics of the sodium channel.
- Molekulargewicht
- 24 kDa (MW of target protein)
-