TRPC3 Antikörper (N-Term)
-
- Target Alle TRPC3 Antikörper anzeigen
- TRPC3 (Transient Receptor Potential Cation Channel, Subfamily C, Member 3 (TRPC3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TRPC3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TRPC3 antibody was raised against the n terminal of TRPC3
- Aufreinigung
- Affinity purified
- Immunogen
- TRPC3 antibody was raised using the N terminal of TRPC3 corresponding to a region with amino acids MEGSPSLRRMTVMREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYG
- Top Product
- Discover our top product TRPC3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TRPC3 Blocking Peptide, catalog no. 33R-5923, is also available for use as a blocking control in assays to test for specificity of this TRPC3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPC3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRPC3 (Transient Receptor Potential Cation Channel, Subfamily C, Member 3 (TRPC3))
- Andere Bezeichnung
- TRPC3 (TRPC3 Produkte)
- Synonyme
- TRPC3 antikoerper, Trpc3 antikoerper, TRP3 antikoerper, Mwk antikoerper, Trcp3 antikoerper, Trp3 antikoerper, Trrp3 antikoerper, TrpC3c antikoerper, transient receptor potential cation channel subfamily C member 3 antikoerper, transient receptor potential cation channel, subfamily C, member 3 antikoerper, TRPC3 antikoerper, Trpc3 antikoerper
- Hintergrund
- TRPC3 is thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. TRPC3 is activated by diacylglycerol (DAG) in a membrane-delimited fashion, independently of protein kinase C, and by inositol-1,4,5-triphosphate receptors (ITPR) with bound IP3. TRPC3 may also be activated by internal calcium store depletion.
- Molekulargewicht
- 97 kDa (MW of target protein)
-