CACNG6 Antikörper (N-Term)

Produktnummer ABIN633735

Produktdetails anti-CACNG6 Antikörper

Target: CACNG6 (Calcium Channel, Voltage-Dependent, gamma Subunit 6 (CACNG6))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CACNG6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CACNG6 antibody was raised against the N terminal of CACNG6

Aufreinigung: Affinity purified

Immunogen: CACNG6 antibody was raised using the N terminal of CACNG6 corresponding to a region with amino acids MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CACNG6 Blocking Peptide, catalog no. 33R-6240, is also available for use as a blocking control in assays to test for specificity of this CACNG6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNG6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CACNG6

Target: CACNG6 (Calcium Channel, Voltage-Dependent, gamma Subunit 6 (CACNG6))

Andere Bezeichnung: CACNG6 (CACNG6 Produkte)

Synonyme: CACNG6 antikoerper, cacng6 antikoerper, MGC122711 antikoerper, 2310033H20Rik antikoerper, AW050150 antikoerper, calcium voltage-gated channel auxiliary subunit gamma 6 antikoerper, calcium channel, voltage-dependent, gamma subunit 6 antikoerper, CACNG6 antikoerper, cacng6 antikoerper, Cacng6 antikoerper

Hintergrund: CACNG6 is thought to stabilize the calcium channel in an inactivated (closed) state.

Molekulargewicht: 28 kDa (MW of target protein)