CACNG6 Antikörper (N-Term)
-
- Target Alle CACNG6 Antikörper anzeigen
- CACNG6 (Calcium Channel, Voltage-Dependent, gamma Subunit 6 (CACNG6))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CACNG6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CACNG6 antibody was raised against the N terminal of CACNG6
- Aufreinigung
- Affinity purified
- Immunogen
- CACNG6 antibody was raised using the N terminal of CACNG6 corresponding to a region with amino acids MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGA
- Top Product
- Discover our top product CACNG6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CACNG6 Blocking Peptide, catalog no. 33R-6240, is also available for use as a blocking control in assays to test for specificity of this CACNG6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNG6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CACNG6 (Calcium Channel, Voltage-Dependent, gamma Subunit 6 (CACNG6))
- Andere Bezeichnung
- CACNG6 (CACNG6 Produkte)
- Synonyme
- CACNG6 antikoerper, cacng6 antikoerper, MGC122711 antikoerper, 2310033H20Rik antikoerper, AW050150 antikoerper, calcium voltage-gated channel auxiliary subunit gamma 6 antikoerper, calcium channel, voltage-dependent, gamma subunit 6 antikoerper, CACNG6 antikoerper, cacng6 antikoerper, Cacng6 antikoerper
- Hintergrund
- CACNG6 is thought to stabilize the calcium channel in an inactivated (closed) state.
- Molekulargewicht
- 28 kDa (MW of target protein)
-