KCNMA1 Antikörper (Middle Region)
-
- Target Alle KCNMA1 Antikörper anzeigen
- KCNMA1 (Potassium Large Conductance Calcium-Activated Channel, Subfamily M, alpha Member 1 (KCNMA1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCNMA1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KCNMA1 antibody was raised against the middle region of KCNMA1
- Aufreinigung
- Affinity purified
- Immunogen
- KCNMA1 antibody was raised using the middle region of KCNMA1 corresponding to a region with amino acids CFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAG
- Top Product
- Discover our top product KCNMA1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCNMA1 Blocking Peptide, catalog no. 33R-1683, is also available for use as a blocking control in assays to test for specificity of this KCNMA1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNMA1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNMA1 (Potassium Large Conductance Calcium-Activated Channel, Subfamily M, alpha Member 1 (KCNMA1))
- Andere Bezeichnung
- KCNMA1 (KCNMA1 Produkte)
- Synonyme
- BKTM antikoerper, KCa1.1 antikoerper, MaxiK antikoerper, SAKCA antikoerper, SLO antikoerper, SLO-ALPHA antikoerper, SLO1 antikoerper, bA205K10.1 antikoerper, mSLO1 antikoerper, DDBDRAFT_0190653 antikoerper, DDBDRAFT_0235401 antikoerper, DDB_0190653 antikoerper, DDB_0235401 antikoerper, KCNMA antikoerper, KCNMA1 antikoerper, 5730414M22Rik antikoerper, BKCa antikoerper, Slo antikoerper, Slo1 antikoerper, mSlo antikoerper, mSlo1 antikoerper, KCNMA1b antikoerper, KCNMA1c antikoerper, Kcnma antikoerper, bktm antikoerper, kcnma1-A antikoerper, sakca antikoerper, cSlo antikoerper, slo1 antikoerper, kcnma1 antikoerper, si:ch211-39f22.2 antikoerper, BcDNA:GH10751 antikoerper, CG10693 antikoerper, Dmel\CG10693 antikoerper, Dslo antikoerper, dSlo antikoerper, dSlo1 antikoerper, dslo antikoerper, fSlo antikoerper, potassium calcium-activated channel subfamily M alpha 1 antikoerper, calcium-activated BK potassium channel, alpha subunit antikoerper, potassium large conductance calcium-activated channel, subfamily M, alpha member 1 antikoerper, potassium calcium-activated channel subfamily M alpha 1 L homeolog antikoerper, potassium large conductance calcium-activated channel, subfamily M, alpha member 1a antikoerper, calcium-activated potassium channel subunit alpha-1 antikoerper, slowpoke antikoerper, KCNMA1 antikoerper, kcnma1 antikoerper, Kcnma1 antikoerper, kcnma1.L antikoerper, kcnma1a antikoerper, LOC100454095 antikoerper, slo antikoerper
- Hintergrund
- MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit, which is the product of this gene, and the modulatory beta subunit. Intracellular calcium regulates the physical association between the alpha and beta subunits.MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability.
- Molekulargewicht
- 131 kDa (MW of target protein)
- Pathways
- Regulation of Hormone Metabolic Process, Sensory Perception of Sound
-