TRPM8 Antikörper (N-Term)

Produktnummer ABIN633722

Produktdetails anti-TRPM8 Antikörper

Target: TRPM8 (Transient Receptor Potential Cation Channel, Subfamily M, Member 8 (TRPM8))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRPM8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRPM8 antibody was raised against the N terminal of TRPM8

Aufreinigung: Affinity purified

Immunogen: TRPM8 antibody was raised using the N terminal of TRPM8 corresponding to a region with amino acids YILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRPM8 Blocking Peptide, catalog no. 33R-10139, is also available for use as a blocking control in assays to test for specificity of this TRPM8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPM8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRPM8

Target: TRPM8 (Transient Receptor Potential Cation Channel, Subfamily M, Member 8 (TRPM8))

Andere Bezeichnung: TRPM8 (TRPM8 Produkte)

Synonyme: TRPM8 antikoerper, trpp8 antikoerper, ltrpc6 antikoerper, trpm8b antikoerper, LTRPC6 antikoerper, TRPP8 antikoerper, CMR1 antikoerper, LTrpC-6 antikoerper, Trp-p8 antikoerper, transient receptor potential cation channel subfamily M member 8 antikoerper, transient receptor potential cation channel subfamily M member 8b L homeolog antikoerper, transient receptor potential cation channel, subfamily M, member 8 antikoerper, TRPM8 antikoerper, trpm8b.L antikoerper, Trpm8 antikoerper

Hintergrund: TRPM8 is the receptor-activated non-selective cation channel involved in detection of sensations such as coolness, by being activated by cold temperature below 25 degrees Celsius. TRPM8 is activated by icilin, eucalyptol, menthol, cold and modulation of intracellular pH. TRPM8 is involved in menthol sensation. TRPM8 is permeable for monovalent cations sodium, potassium, and cesium and divalent cation calcium. Temperature sensing is tightly linked to voltage-dependent gating. TRPM8 was activated upon depolarization, changes in temperature resulting in graded shifts of its voltage-dependent activation curves. The chemical agonists menthol functions as a gating modifier, shifting activation curves towards physiological membrane potentials. Temperature sensitivity arises from a tenfold difference in the activation energies associated with voltage-dependent opening and closing.

Molekulargewicht: 128 kDa (MW of target protein)