KCNA1 Antikörper (Middle Region)

Produktnummer ABIN633721

Produktdetails anti-KCNA1 Antikörper

Target: KCNA1 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 1 (KCNA1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCNA1 antibody was raised against the middle region of KCNA1

Aufreinigung: Affinity purified

Immunogen: KCNA1 antibody was raised using the middle region of KCNA1 corresponding to a region with amino acids ISIVIFCLETLPELKDDKDFTGTVHRIDNTTVIYNSNIFTDPFFIVETLC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNA1 Blocking Peptide, catalog no. 33R-4154, is also available for use as a blocking control in assays to test for specificity of this KCNA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNA1

Target: KCNA1 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 1 (KCNA1))

Andere Bezeichnung: KCNA1 (KCNA1 Produkte)

Synonyme: AEMK antikoerper, EA1 antikoerper, HBK1 antikoerper, HUK1 antikoerper, KV1.1 antikoerper, MBK1 antikoerper, MK1 antikoerper, RBK1 antikoerper, KCNA1 antikoerper, AI840627 antikoerper, Kca1-1 antikoerper, Kv1.1 antikoerper, Mk-1 antikoerper, Shak antikoerper, mceph antikoerper, Kcna antikoerper, Kcpvd antikoerper, potassium voltage-gated channel subfamily A member 1 antikoerper, potassium voltage-gated channel, shaker-related subfamily, member 1 antikoerper, fragile site, aphidicolin type, common, fra(12)(q24) antikoerper, KCNA1 antikoerper, Kcna1 antikoerper, FRA12E antikoerper

Hintergrund: KCNA1 mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.

Molekulargewicht: 56 kDa (MW of target protein)