P2RX2 Antikörper (N-Term)
-
- Target Alle P2RX2 Antikörper anzeigen
- P2RX2 (Purinergic Receptor P2X, Ligand Gated Ion Channel 2 (P2RX2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser P2RX2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- P2 RX2 antibody was raised against the N terminal of P2 X2
- Aufreinigung
- Affinity purified
- Immunogen
- P2 RX2 antibody was raised using the N terminal of P2 X2 corresponding to a region with amino acids VRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQESETGPESSIITKVKGI
- Top Product
- Discover our top product P2RX2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
P2RX2 Blocking Peptide, catalog no. 33R-9779, is also available for use as a blocking control in assays to test for specificity of this P2RX2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 X2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- P2RX2 (Purinergic Receptor P2X, Ligand Gated Ion Channel 2 (P2RX2))
- Andere Bezeichnung
- P2RX2 (P2RX2 Produkte)
- Synonyme
- DFNA41 antikoerper, P2X2 antikoerper, P2X2a antikoerper, P2x2 antikoerper, p2xr2 antikoerper, P2RX2 antikoerper, purinergic receptor P2X 2 antikoerper, purinergic receptor P2X, ligand-gated ion channel, 2 antikoerper, P2RX2 antikoerper, P2rx2 antikoerper, p2rx2 antikoerper
- Hintergrund
- The product of P2RX2 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Six transcript variants encoding six distinct isoforms have been identified for this gene.
- Molekulargewicht
- 49 kDa (MW of target protein)
- Pathways
- Skeletal Muscle Fiber Development, Positive Regulation of Endopeptidase Activity
-