KCNJ1 Antikörper (Middle Region)

Produktnummer ABIN633717

Produktdetails anti-KCNJ1 Antikörper

Target: KCNJ1 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 1 (KCNJ1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNJ1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCNJ1 antibody was raised against the middle region of KCNJ1

Aufreinigung: Affinity purified

Immunogen: KCNJ1 antibody was raised using the middle region of KCNJ1 corresponding to a region with amino acids LRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNJ1 Blocking Peptide, catalog no. 33R-5365, is also available for use as a blocking control in assays to test for specificity of this KCNJ1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNJ1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNJ1

Target: KCNJ1 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 1 (KCNJ1))

Andere Bezeichnung: KCNJ1 (KCNJ1 Produkte)

Synonyme: KIR1.1 antikoerper, ROMK antikoerper, ROMK1 antikoerper, kir1.1 antikoerper, romk1 antikoerper, Kcnj antikoerper, Kir1.1 antikoerper, Romk2 antikoerper, kcnj1 antikoerper, wu:fl37c05 antikoerper, zgc:63534 antikoerper, potassium voltage-gated channel subfamily J member 1 antikoerper, potassium voltage-gated channel subfamily J member 1 L homeolog antikoerper, potassium inwardly-rectifying channel, subfamily J, member 1 antikoerper, potassium inwardly-rectifying channel, subfamily J, member 1a, tandem duplicate 1 antikoerper, KCNJ1 antikoerper, kcnj1.L antikoerper, kcnj1 antikoerper, Kcnj1 antikoerper, kcnj1a.1 antikoerper

Hintergrund: KCNJ1 has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Mutations in this gene have been associated with antenatal Bartter syndrome, which is characterized by salt wasting, hypokalemic alkalosis, hypercalciuria, and low blood pressure. Multiple transcript variants encoding different isoforms have been found for KCNJ1.

Molekulargewicht: 45 kDa (MW of target protein)