KCNJ1 Antikörper (C-Term, Intracellular)

Produktnummer ABIN7043467

Produktdetails anti-KCNJ1 Antikörper

Target: KCNJ1 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 1 (KCNJ1))

Bindungsspezifität: AA 342-391, C-Term, Intracellular

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNJ1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunocytochemistry (ICC), Immunoprecipitation (IP)

Produktmerkmale: Anti-KCNJ1 (Kir1.1) Antibody (ABIN7043467, ABIN7044897 and ABIN7044898)) is a highly specific antibody directed against an epitope of the rat potassium channel ROM-K. The antibody can be used in western blot, immunohistochemistry, immunocytochemistry, and immunoprecipitation applications. It has been designed to recognize ROMK1 from rat, mouse, and human samples.

Aufreinigung: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

Immunogen:

Immunogen: GST fusion protein

Immunogen Sequence: GST fusion protein with the sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDET DDTQM, corresponding to amino acids 342-391 of rat KCNJ1

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: 25 μL, 50 μL or 0.2 mL double distilled water (DDW), depending on the sample size.

Konzentration: 0.8 mg/mL

Buffer: Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1 % BSA, 0.05 % Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: RT,4 °C,-20 °C

Informationen zur Lagerung:

Storage before reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.

Storage after reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Details zu KCNJ1

Target: KCNJ1 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 1 (KCNJ1))

Andere Bezeichnung: KCNJ1 (Kir1.1) (KCNJ1 Produkte)

Synonyme: KIR1.1 antikoerper, ROMK antikoerper, ROMK1 antikoerper, kir1.1 antikoerper, romk1 antikoerper, Kcnj antikoerper, Kir1.1 antikoerper, Romk2 antikoerper, kcnj1 antikoerper, wu:fl37c05 antikoerper, zgc:63534 antikoerper, potassium voltage-gated channel subfamily J member 1 antikoerper, potassium voltage-gated channel subfamily J member 1 L homeolog antikoerper, potassium inwardly-rectifying channel, subfamily J, member 1 antikoerper, potassium inwardly-rectifying channel, subfamily J, member 1a, tandem duplicate 1 antikoerper, KCNJ1 antikoerper, kcnj1.L antikoerper, kcnj1 antikoerper, Kcnj1 antikoerper, kcnj1a.1 antikoerper

Hintergrund: Alternative names: KCNJ1 (Kir1.1), ROMK1, ATP-sensitive inward rectifier potassium channel 1

Gen-ID: 24521

NCBI Accession: NM_000220

UniProt: P35560