CACNA2D1 Antikörper (Middle Region)

Produktnummer ABIN633675

Produktdetails anti-CACNA2D1 Antikörper

Target: CACNA2D1 (Calcium Channel, Voltage-Dependent, alpha 2/delta Subunit 1 (CACNA2D1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CACNA2D1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CACNA2 D1 antibody was raised against the middle region of CACNA2 1

Aufreinigung: Affinity purified

Immunogen: CACNA2 D1 antibody was raised using the middle region of CACNA2 1 corresponding to a region with amino acids PKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYI

Anwendungsinformationen

Applikationshinweise: WB: 0.12 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CACNA2D1 Blocking Peptide, catalog no. 33R-7178, is also available for use as a blocking control in assays to test for specificity of this CACNA2D1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNA0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CACNA2D1

Target: CACNA2D1 (Calcium Channel, Voltage-Dependent, alpha 2/delta Subunit 1 (CACNA2D1))

Andere Bezeichnung: CACNA2D1 (CACNA2D1 Produkte)

Synonyme: CACNA2D1 antikoerper, DKFZp469K2211 antikoerper, CACNA2 antikoerper, CACNL2A antikoerper, CCHL2A antikoerper, Ca(v)alpha2delta1 antikoerper, Cacna2 antikoerper, Cchl2a antikoerper, CCHLA2 antikoerper, DHSCCA antikoerper, calcium voltage-gated channel auxiliary subunit alpha2delta 1 antikoerper, calcium channel, voltage-dependent, alpha 2/delta subunit 1 antikoerper, calcium channel, voltage-dependent, alpha2/delta subunit 1 antikoerper, CACNA2D1 antikoerper, cacna2d1 antikoerper, Cacna2d1 antikoerper

Hintergrund: CACNA2D1 encodes a member of the alpha-2/delta subunit family, a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio.

Molekulargewicht: 120 kDa (MW of target protein)