CACNB2 Antikörper (Middle Region)
-
- Target Alle CACNB2 Antikörper anzeigen
- CACNB2 (Calcium Channel, Voltage-Dependent, beta 2 Subunit (CACNB2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CACNB2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CACNB2 antibody was raised against the middle region of CACNB2
- Aufreinigung
- Affinity purified
- Immunogen
- CACNB2 antibody was raised using the middle region of CACNB2 corresponding to a region with amino acids AYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGSQGDQRTDRSA
- Top Product
- Discover our top product CACNB2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CACNB2 Blocking Peptide, catalog no. 33R-1636, is also available for use as a blocking control in assays to test for specificity of this CACNB2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNB2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CACNB2 (Calcium Channel, Voltage-Dependent, beta 2 Subunit (CACNB2))
- Andere Bezeichnung
- CACNB2 (CACNB2 Produkte)
- Synonyme
- CACNLB2 antikoerper, CAVB2 antikoerper, MYSB antikoerper, AW060387 antikoerper, CAB2 antikoerper, Cavbeta2 antikoerper, Cchb2 antikoerper, Cacnlb2 antikoerper, Cacnb2 antikoerper, CACNB2 antikoerper, CACNB2.2 antikoerper, cacnb2a antikoerper, im:7141271 antikoerper, si:dkey-32m20.2 antikoerper, calcium voltage-gated channel auxiliary subunit beta 2 antikoerper, calcium channel, voltage-dependent, beta 2 subunit antikoerper, calcium channel, voltage-dependent, beta 2b antikoerper, CACNB2 antikoerper, Cacnb2 antikoerper, cacnb2b antikoerper
- Hintergrund
- CACNB2 belongs to the calcium channel beta subunit family.
- Molekulargewicht
- 68 kDa (MW of target protein)
- Pathways
- Skeletal Muscle Fiber Development
-