EIF1AX Antikörper (Middle Region)

Produktnummer ABIN633587

Produktdetails anti-EIF1AX Antikörper

Target: EIF1AX (Eukaryotic Translation Initiation Factor 1A, X-Linked (EIF1AX))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EIF1AX Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EIF1 AX antibody was raised against the middle region of EIF1 X

Aufreinigung: Affinity purified

Immunogen: EIF1 AX antibody was raised using the middle region of EIF1 X corresponding to a region with amino acids KYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF1AX Blocking Peptide, catalog no. 33R-4747, is also available for use as a blocking control in assays to test for specificity of this EIF1AX antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 X antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EIF1AX

Target: EIF1AX (Eukaryotic Translation Initiation Factor 1A, X-Linked (EIF1AX))

Andere Bezeichnung: EIF1AX (EIF1AX Produkte)

Synonyme: Eif1ay antikoerper, RGD1560198 antikoerper, 1500010B24Rik antikoerper, AI426898 antikoerper, EIF1A antikoerper, EIF1AP1 antikoerper, EIF4C antikoerper, eIF-1A antikoerper, eIF-4C antikoerper, eif-1a antikoerper, eif-4c antikoerper, eif1a antikoerper, eif1ap1 antikoerper, eif1ax antikoerper, eif4c antikoerper, zgc:101670 antikoerper, EIF1AY antikoerper, eukaryotic translation initiation factor 1A, X-linked antikoerper, eukaryotic translation initiation factor 1A, X-linked S homeolog antikoerper, eukaryotic translation initiation factor 1A, X-linked, a antikoerper, Eif1ax antikoerper, EIF1AX antikoerper, eif1ax.S antikoerper, eif1axa antikoerper

Hintergrund: This gene encodes an essential eukaryotic translation initiation factor. The protein is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5' end of capped RNA.

Molekulargewicht: 16 kDa (MW of target protein)