PTBP2 Antikörper (N-Term)

Produktnummer ABIN633535

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch PTBP2 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für PTBP2 Antikörper (N-Term) (ABIN633535)

Target: PTBP2 (Polypyrimidine Tract Binding Protein 2 (PTBP2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PTBP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PTBP2 Antikörper

Bindungsspezifität: N-Term

Spezifität: PTBP2 antibody was raised against the N terminal of PTBP2

Aufreinigung: Affinity purified

Immunogen: PTBP2 antibody was raised using the N terminal of PTBP2 corresponding to a region with amino acids AITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQAVLQAVTAV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PTBP2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this PTBP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTBP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PTBP2

Target: PTBP2 (Polypyrimidine Tract Binding Protein 2 (PTBP2))

Andere Bezeichnung: PTBP2

Hintergrund: The protein encoded by this gene binds to the intronic cluster of RNA regulatory elements, downstream control sequence (DCS). It is implicated in controlling the assembly of other splicing-regulatory proteins.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, SARS-CoV-2 Protein Interaktom