PTBP2 Antikörper (N-Term)
-
- Target Alle PTBP2 Antikörper anzeigen
- PTBP2 (Polypyrimidine Tract Binding Protein 2 (PTBP2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PTBP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PTBP2 antibody was raised against the N terminal of PTBP2
- Aufreinigung
- Affinity purified
- Immunogen
- PTBP2 antibody was raised using the N terminal of PTBP2 corresponding to a region with amino acids AITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQAVLQAVTAV
- Top Product
- Discover our top product PTBP2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PTBP2 Blocking Peptide, catalog no. 33R-1284, is also available for use as a blocking control in assays to test for specificity of this PTBP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTBP2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PTBP2 (Polypyrimidine Tract Binding Protein 2 (PTBP2))
- Andere Bezeichnung
- PTBP2 (PTBP2 Produkte)
- Synonyme
- PTB antikoerper, PTBLP antikoerper, brPTB antikoerper, nPTB antikoerper, nPTB5 antikoerper, nPTB6 antikoerper, nPTB7 antikoerper, nPTB8 antikoerper, Ptb2 antikoerper, PTBP2 antikoerper, im:7153495 antikoerper, ptbp2 antikoerper, si:ch211-160l17.2 antikoerper, wu:fa08f05 antikoerper, wu:fc05d10 antikoerper, zgc:113074 antikoerper, polypyrimidine tract binding protein 2 antikoerper, polypyrimidine tract binding protein 2b antikoerper, polypyrimidine tract binding protein 2a antikoerper, PTBP2 antikoerper, Ptbp2 antikoerper, ptbp2b antikoerper, ptbp2a antikoerper
- Hintergrund
- The protein encoded by this gene binds to the intronic cluster of RNA regulatory elements, downstream control sequence (DCS). It is implicated in controlling the assembly of other splicing-regulatory proteins.
- Molekulargewicht
- 57 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, SARS-CoV-2 Protein Interaktom
-