LSM6 Antikörper
-
- Target Alle LSM6 Antikörper anzeigen
- LSM6 (LSM6 Homolog, U6 Small Nuclear RNA Associated (LSM6))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LSM6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- LSM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids YRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRR
- Top Product
- Discover our top product LSM6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LSM6 Blocking Peptide, catalog no. 33R-10223, is also available for use as a blocking control in assays to test for specificity of this LSM6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSM6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LSM6 (LSM6 Homolog, U6 Small Nuclear RNA Associated (LSM6))
- Andere Bezeichnung
- LSM6 (LSM6 Produkte)
- Synonyme
- zgc:92379 antikoerper, YDR378C antikoerper, 1500031N17Rik antikoerper, 2410088K19Rik antikoerper, AI747288 antikoerper, RGD1561937 antikoerper, LSM6 homolog, U6 small nuclear RNA and mRNA degradation associated S homeolog antikoerper, LSM6 homolog, U6 small nuclear RNA and mRNA degradation associated antikoerper, lsm6.S antikoerper, lsm6 antikoerper, LSM6 antikoerper, Lsm6 antikoerper
- Hintergrund
- Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.
- Molekulargewicht
- 9 kDa (MW of target protein)
-