EIF4G1 Antikörper (Middle Region)

Produktnummer ABIN633448

Produktdetails anti-EIF4G1 Antikörper

Target: EIF4G1 (Eukaryotic Translation Initiation Factor 4 Gamma, 1 (EIF4G1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EIF4G1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EIF4 G1 antibody was raised against the middle region of EIF4 1

Aufreinigung: Affinity purified

Immunogen: EIF4 G1 antibody was raised using the middle region of EIF4 1 corresponding to a region with amino acids PAVPEVENQPPAGSNPGPESEGSGVPPRPEEADETWDSKEDKIHNAENIQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF4G1 Blocking Peptide, catalog no. 33R-6989, is also available for use as a blocking control in assays to test for specificity of this EIF4G1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EIF4G1

Target: EIF4G1 (Eukaryotic Translation Initiation Factor 4 Gamma, 1 (EIF4G1))

Andere Bezeichnung: EIF4G1 (EIF4G1 Produkte)

Synonyme: EIF4GI antikoerper, CG10811 antikoerper, Dmel\\CG10811 antikoerper, EIF4G antikoerper, Eif4G antikoerper, deIF4G antikoerper, eIF-4G antikoerper, eIF4g antikoerper, p200 antikoerper, EIF4G1 antikoerper, wu:fb50a05 antikoerper, wu:fc60b06 antikoerper, eif4g antikoerper, CUCUMOVIRUS MULTIPLICATION 2 antikoerper, CUM2 antikoerper, EUKARYOTIC TRANSLATION INITIATION FACTOR 4G antikoerper, eukaryotic translation initiation factor 4G antikoerper, DDBDRAFT_0217646 antikoerper, DDBDRAFT_0217647 antikoerper, DDBDRAFT_0234257 antikoerper, DDB_0217646 antikoerper, DDB_0217647 antikoerper, DDB_0234257 antikoerper, NV18824 antikoerper, EIF-4G1 antikoerper, EIF4F antikoerper, P220 antikoerper, PARK18 antikoerper, p220 antikoerper, E030015G23Rik antikoerper, eIF4GI antikoerper, eukaryotic translation initiation factor 4 gamma 1 antikoerper, eukaryotic translation initiation factor 4G antikoerper, eukaryotic translation initiation factor 4 gamma, 1a antikoerper, eukaryotic translation initiation factor 4 gamma, 1 S homeolog antikoerper, eukaryotic initiation factor antikoerper, eukaryotic translation initiation factor 4 gamma antikoerper, eukaryotic translation initiation factor 4 gamma, 1 antikoerper, eukaryotic translation initiation factor 4, gamma 1 antikoerper, EIF4G1 antikoerper, eIF4G antikoerper, eif4g1a antikoerper, LOC704923 antikoerper, eif4g1.S antikoerper, EIF4G antikoerper, eIF4g antikoerper, Eif4g antikoerper, Eif4g1 antikoerper

Hintergrund: EIF4G1 is a component of the protein complex EIF4F, which is involved in the recognition of the mRNA cap, ATP-dependent unwinding of 5'-terminal secondary structure, and recruitment of mRNA to the ribosome.

Molekulargewicht: 175 kDa (MW of target protein)