MSI2 Antikörper
-
- Target Alle MSI2 Antikörper anzeigen
- MSI2 (Musashi Homolog 2 (MSI2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MSI2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- MSI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPDYLPVSQDIIFI
- Top Product
- Discover our top product MSI2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MSI2 Blocking Peptide, catalog no. 33R-10266, is also available for use as a blocking control in assays to test for specificity of this MSI2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSI2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MSI2 (Musashi Homolog 2 (MSI2))
- Andere Bezeichnung
- MSI2 (MSI2 Produkte)
- Synonyme
- MSI2H antikoerper, 1700105C15Rik antikoerper, AI451722 antikoerper, AI563628 antikoerper, AW489193 antikoerper, Msi2h antikoerper, RGD1560397 antikoerper, MSI2 antikoerper, musashi-2 antikoerper, musashi2 antikoerper, xrp1 antikoerper, msi2 antikoerper, zgc:174035 antikoerper, zgc:63812 antikoerper, cb746 antikoerper, fi47b09 antikoerper, wu:fb02d08 antikoerper, wu:fi32d12 antikoerper, wu:fi47b09 antikoerper, musashi RNA binding protein 2 antikoerper, musashi RNA-binding protein 2 antikoerper, musashi RNA binding protein 2 S homeolog antikoerper, musashi RNA-binding protein 2b antikoerper, musashi RNA-binding protein 2a antikoerper, MSI2 antikoerper, Msi2 antikoerper, msi2.S antikoerper, msi2 antikoerper, msi2b antikoerper, msi2a antikoerper
- Hintergrund
- MSI2 contains two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation.
- Molekulargewicht
- 28 kDa (MW of target protein)
-