KARS Antikörper (C-Term)

Produktnummer ABIN633328

Produktdetails anti-KARS Antikörper

Target: KARS (Lysyl-tRNA Synthetase (KARS))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KARS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: KARS antibody was raised against the C terminal of KARS

Aufreinigung: Affinity purified

Immunogen: KARS antibody was raised using the C terminal of KARS corresponding to a region with amino acids GMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KARS Blocking Peptide, catalog no. 33R-3434, is also available for use as a blocking control in assays to test for specificity of this KARS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KARS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KARS

Target: KARS (Lysyl-tRNA Synthetase (KARS))

Andere Bezeichnung: KARS (KARS Produkte)

Synonyme: CG12141 antikoerper, Dmel\\CG12141 antikoerper, KRS antikoerper, LysRS antikoerper, cb530 antikoerper, wu:fa16h02 antikoerper, zgc:92483 antikoerper, kars antikoerper, MGC53345 antikoerper, kars2 antikoerper, krs antikoerper, krs-1 antikoerper, KARS antikoerper, Tb06.28P18.190 antikoerper, CMTRIB antikoerper, DFNB89 antikoerper, KARS1 antikoerper, KARS2 antikoerper, AA589550 antikoerper, AL024334 antikoerper, AL033315 antikoerper, AL033367 antikoerper, D8Ertd698e antikoerper, D8Wsu108e antikoerper, mKIAA0070 antikoerper, Lysyl-tRNA synthetase antikoerper, lysyl-tRNA synthetase antikoerper, lysyl-tRNA synthetase S homeolog antikoerper, lysyl-tRNA synthetase L homeolog antikoerper, LysRS antikoerper, kars antikoerper, kars.S antikoerper, kars.L antikoerper, Bm1_16500 antikoerper, lysS antikoerper, Taci_1118 antikoerper, Tpau_1737 antikoerper, Arch_0261 antikoerper, Trad_2960 antikoerper, Spirs_3699 antikoerper, KARS antikoerper, LOC100280510 antikoerper, Tb927.6.1510 antikoerper, Kars antikoerper

Hintergrund: Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Lysyl-tRNA synthetase is a homodimer localized to the cytoplasm which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis.

Molekulargewicht: 66 kDa (MW of target protein)