UPF3A Antikörper
-
- Target Alle UPF3A Antikörper anzeigen
- UPF3A (UPF3 Regulator of Nonsense Transcripts Homolog A (UPF3A))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UPF3A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- UPF3 A antibody was raised using a synthetic peptide corresponding to a region with amino acids QRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKKGSQDSGAPG
- Top Product
- Discover our top product UPF3A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UPF3A Blocking Peptide, catalog no. 33R-7719, is also available for use as a blocking control in assays to test for specificity of this UPF3A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UPF0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UPF3A (UPF3 Regulator of Nonsense Transcripts Homolog A (UPF3A))
- Andere Bezeichnung
- UPF3A (UPF3A Produkte)
- Synonyme
- 2600001C03Rik antikoerper, 4930546M19Rik antikoerper, RENT3A antikoerper, UPF3 antikoerper, UPF3A antikoerper, HUPF3A antikoerper, si:dkey-21o13.6 antikoerper, UPF3 regulator of nonsense transcripts homolog A (yeast) antikoerper, UPF3A, regulator of nonsense mediated mRNA decay antikoerper, Upf3a antikoerper, UPF3A antikoerper, upf3a antikoerper
- Hintergrund
- UPF3A is part of a multiprotein post-splicing mRNP complex involved in both mRNA nuclear export and mRNA surveillance. UPF3A is involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons.
- Molekulargewicht
- 55 kDa (MW of target protein)
-