IMP3 Antikörper
-
- Target Alle IMP3 Antikörper anzeigen
- IMP3 (IMP3, U3 Small Nucleolar Ribonucleoprotein (IMP3))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IMP3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- IMP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids GHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLE
- Top Product
- Discover our top product IMP3 Primärantikörper
-
anti-IMP3, U3 Small Nucleolar Ribonucleoprotein (IMP3) (AA 135-184) antibody
IMP3 Reaktivität: Human WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-IMP3, U3 Small Nucleolar Ribonucleoprotein (IMP3) (AA 156-184) antibodyIMP3 Reaktivität: Human, Maus WB, ELISA, IHC, FACS Wirt: Kaninchen Polyclonal unconjugated
anti-IMP3, U3 Small Nucleolar Ribonucleoprotein (IMP3) (AA 156-184), (C-Term) antibodyIMP3 Reaktivität: Human, Maus WB, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB24885 unconjugated
anti-IMP3, U3 Small Nucleolar Ribonucleoprotein (IMP3) antibodyIMP3 Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-IMP3, U3 Small Nucleolar Ribonucleoprotein (IMP3) (C-Term) antibodyIMP3 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Kaninchen, Meerschweinchen, Zebrafisch (Danio rerio), Schwein, Fledermaus, Affe, Hamster WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-IMP3, U3 Small Nucleolar Ribonucleoprotein (IMP3) (Middle Region) antibodyIMP3 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Kaninchen, Meerschweinchen, Zebrafisch (Danio rerio) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-IMP3, U3 Small Nucleolar Ribonucleoprotein (IMP3) (AA 155-184), (C-Term) antibodyIMP3 Reaktivität: Human WB, FACS, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
anti-IMP3, U3 Small Nucleolar Ribonucleoprotein (IMP3) (Internal Region) antibodyVerified IMP3 Reaktivität: Human WB, ELISA Wirt: Ziege Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IMP3 Blocking Peptide, catalog no. 33R-3318, is also available for use as a blocking control in assays to test for specificity of this IMP3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMP3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IMP3 (IMP3, U3 Small Nucleolar Ribonucleoprotein (IMP3))
- Andere Bezeichnung
- IMP3 (IMP3 Produkte)
- Synonyme
- BRMS2 antikoerper, C15orf12 antikoerper, MRPS4 antikoerper, 1190002L16Rik antikoerper, AI256594 antikoerper, RGD1306825 antikoerper, zgc:56526 antikoerper, imp3 antikoerper, IMP3, U3 small nucleolar ribonucleoprotein antikoerper, IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast) antikoerper, inositol monophosphatase domain containing 1 antikoerper, IMP3, U3 small nucleolar ribonucleoprotein L homeolog antikoerper, IMP3 antikoerper, Imp3 antikoerper, imp3 antikoerper, IMPAD1 antikoerper, imp3.L antikoerper
- Hintergrund
- This gene encodes the human homolog of the yeast Imp3 protein. The protein localizes to the nucleoli and interacts with the U3 snoRNP complex. The protein contains an S4 domain.
- Molekulargewicht
- 22 kDa (MW of target protein)
-
