IMP3 Antikörper

Produktnummer ABIN633282

Der Kaninchen Polyklonal anti-IMP3 Antikörper (ABIN633282) detektiert spezifisch IMP3 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für IMP3 Antikörper (ABIN633282)

Target: IMP3 (IMP3, U3 Small Nucleolar Ribonucleoprotein (IMP3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IMP3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IMP3 Antikörper

Aufreinigung: Affinity purified

Immunogen: IMP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids GHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IMP3 Blocking Peptide, (ABIN938704), is also available for use as a blocking control in assays to test for specificity of this IMP3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMP3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IMP3

Target: IMP3 (IMP3, U3 Small Nucleolar Ribonucleoprotein (IMP3))

Andere Bezeichnung: IMP3

Hintergrund: This gene encodes the human homolog of the yeast Imp3 protein. The protein localizes to the nucleoli and interacts with the U3 snoRNP complex. The protein contains an S4 domain.

Molekulargewicht: 22 kDa (MW of target protein)